PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe7G261900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family LBD
Protein Properties Length: 154aa    MW: 17577 Da    PI: 7.3365
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe7G261900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.15.9e-3861051100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +Ca+C++lrr+C++dCvlapyf +++p++f +vh++FGasnv+++l +lp  +r +a++++ yeA  r+rdPvyG++g+i +lqqq++ l+ 
  Aqcoe7G261900.1.p   6 RCAGCRYLRRRCPEDCVLAPYFLSSNPERFICVHRIFGASNVSRMLMQLPVVHRAAAADCMSYEAANRVRDPVYGCTGIIYQLQQQIAMLER 97 
                        6******************************************************************************************* PP

             DUF260  93 elallkee 100
                        ela+++ e
  Aqcoe7G261900.1.p  98 ELAKAQGE 105
                        ***99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.8485106IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-376103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MANPTRCAGC RYLRRRCPED CVLAPYFLSS NPERFICVHR IFGASNVSRM LMQLPVVHRA  60
AAADCMSYEA ANRVRDPVYG CTGIIYQLQQ QIAMLERELA KAQGEIAFYN AQQQEMNRDQ  120
DQGESSLFNA SQQQPFHLDQ QLLLHYYQLN LNP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010270542.11e-57PREDICTED: LOB domain-containing protein 24-like isoform X2
SwissprotP594689e-44LBD24_ARATH; LOB domain-containing protein 24
TrEMBLM5WY373e-50M5WY37_PRUPE; Uncharacterized protein
STRINGGSMUA_Achr11P04980_0016e-47(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.17e-45LOB domain-containing protein 24